Septin 8 (SEPT8) (NM_001098813) Human Mass Spec Standard
CAT#: PH316253
SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092283)
View other "Septin 8" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092283) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216253 |
Predicted MW | 43.3 kDa |
Protein Sequence |
>RC216253 representing NM_001098813
Red=Cloning site Green=Tags(s) MNTLFNTTFETEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFEN YLQEELKIRRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFK IKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENH CDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRK EEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQS QALHATSQQPLRKDKDKKN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001092283 |
RefSeq Size | 4270 |
RefSeq ORF | 1107 |
Synonyms | SEP2; SEPT8 |
Locus ID | 23176 |
Cytogenetics | 5q31.1 |
Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414742 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420343 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420345 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414742 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 2 |
CNY 4,840.00 |
|
LY420343 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 1 |
CNY 4,840.00 |
|
LY420345 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 4 |
CNY 3,080.00 |
|
PH313550 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_055961) |
CNY 14,250.00 |
|
PH322095 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092281) |
CNY 14,250.00 |
|
TP313550 | Purified recombinant protein of Homo sapiens septin 8 (SEPT8), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP316253 | Recombinant protein of human septin 8 (SEPT8), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP322095 | Recombinant protein of human septin 8 (SEPT8), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Septin 8产品