SH3GL2 (NM_003026) Human Recombinant Protein
CAT#: TP315806
Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), 20 µg
View other "SH3GL2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215806 representing NM_003026
Red=Cloning site Green=Tags(s) MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSM INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI DPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIE QVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHT GTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL PH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003017 |
Locus ID | 6456 |
UniProt ID | Q99962, Q7Z376 |
Refseq Size | 2540 |
Cytogenetics | 9p22.2 |
Refseq ORF | 1056 |
Synonyms | CNSA2; EEN-B1; SH3D2A; SH3P4 |
Summary | Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Required for BDNF-dependent dendrite outgrowth. Cooperates with SH3GL2 to mediate BDNF-NTRK2 early endocytic trafficking and signaling from early endosomes.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418947 | SH3GL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418947 | Transient overexpression lysate of SH3-domain GRB2-like 2 (SH3GL2) |
CNY 3,080.00 |
|
PH315806 | SH3GL2 MS Standard C13 and N15-labeled recombinant protein (NP_003017) |
CNY 19,520.00 |
|
TP710152 | Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |