SM22 alpha (TAGLN) (NM_003186) Human Recombinant Protein
CAT#: TP315789
Recombinant protein of human transgelin (TAGLN), transcript variant 2, 20 µg
View other "SM22 alpha" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215789 representing NM_003186
Red=Cloning site Green=Tags(s) MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003177 |
Locus ID | 6876 |
UniProt ID | Q01995 |
Refseq Size | 1177 |
Cytogenetics | 11q23.3 |
Refseq ORF | 603 |
Synonyms | SM22; SM22-alpha; SMCC; TAGLN1; WS3-10 |
Summary | This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. [provided by RefSeq, Aug 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401104 | TAGLN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424369 | TAGLN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401104 | Transient overexpression lysate of transgelin (TAGLN), transcript variant 2 |
CNY 3,080.00 |
|
LY424369 | Transient overexpression lysate of transgelin (TAGLN), transcript variant 1 |
CNY 3,080.00 |
|
PH302448 | TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_001001522) |
CNY 19,520.00 |
|
PH315789 | TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_003177) |
CNY 19,520.00 |
|
TP302448 | Recombinant protein of human transgelin (TAGLN), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它SM22 alpha产品