SM22 alpha (TAGLN) (NM_003186) Human Mass Spec Standard
CAT#: PH315789
TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_003177)
View other "SM22 alpha" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_003177) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215789 |
Predicted MW | 22.4 kDa |
Protein Sequence |
>RC215789 representing NM_003186
Red=Cloning site Green=Tags(s) MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003177 |
RefSeq Size | 1177 |
RefSeq ORF | 603 |
Synonyms | SM22; SM22-alpha; SMCC; TAGLN1; WS3-10 |
Locus ID | 6876 |
Cytogenetics | 11q23.3 |
Summary | This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. [provided by RefSeq, Aug 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401104 | TAGLN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424369 | TAGLN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401104 | Transient overexpression lysate of transgelin (TAGLN), transcript variant 2 |
CNY 3,080.00 |
|
LY424369 | Transient overexpression lysate of transgelin (TAGLN), transcript variant 1 |
CNY 3,080.00 |
|
PH302448 | TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_001001522) |
CNY 19,520.00 |
|
TP302448 | Recombinant protein of human transgelin (TAGLN), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315789 | Recombinant protein of human transgelin (TAGLN), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它SM22 alpha产品