Reticulon 1 (RTN1) (NM_206852) Human Recombinant Protein
CAT#: TP315669
Recombinant protein of human reticulon 1 (RTN1), transcript variant 3, 20 µg
View other "Reticulon 1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215669 representing NM_206852
Red=Cloning site Green=Tags(s) MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISF RIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVL MWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996734 |
Locus ID | 6252 |
UniProt ID | Q16799, A8K3B9 |
Refseq Size | 1710 |
Cytogenetics | 14q23.1 |
Refseq ORF | 624 |
Synonyms | NSP |
Summary | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404239 | RTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412069 | RTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404239 | Transient overexpression lysate of reticulon 1 (RTN1), transcript variant 3 |
CNY 3,080.00 |
|
LY412069 | Transient overexpression lysate of reticulon 1 (RTN1), transcript variant 1 |
CNY 3,080.00 |
|
PH310322 | RTN1 MS Standard C13 and N15-labeled recombinant protein (NP_066959) |
CNY 19,520.00 |
|
PH315669 | RTN1 MS Standard C13 and N15-labeled recombinant protein (NP_996734) |
CNY 14,250.00 |
|
TP310322 | Recombinant protein of human reticulon 1 (RTN1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Reticulon 1产品