Reticulon 1 (RTN1) (NM_206852) Human Mass Spec Standard
CAT#: PH315669
RTN1 MS Standard C13 and N15-labeled recombinant protein (NP_996734)
View other "Reticulon 1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | RTN1 MS Standard C13 and N15-labeled recombinant protein (NP_996734) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215669 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC215669 representing NM_206852
Red=Cloning site Green=Tags(s) MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISF RIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVL MWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_996734 |
RefSeq Size | 1710 |
RefSeq ORF | 624 |
Synonyms | NSP |
Locus ID | 6252 |
Cytogenetics | 14q23.1 |
Summary | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404239 | RTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412069 | RTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404239 | Transient overexpression lysate of reticulon 1 (RTN1), transcript variant 3 |
CNY 3,080.00 |
|
LY412069 | Transient overexpression lysate of reticulon 1 (RTN1), transcript variant 1 |
CNY 3,080.00 |
|
PH310322 | RTN1 MS Standard C13 and N15-labeled recombinant protein (NP_066959) |
CNY 19,520.00 |
|
TP310322 | Recombinant protein of human reticulon 1 (RTN1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315669 | Recombinant protein of human reticulon 1 (RTN1), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Reticulon 1产品