HES5 (NM_001010926) Human Recombinant Protein
CAT#: TP315311
Recombinant protein of human hairy and enhancer of split 5 (Drosophila) (HES5), 20 µg
View other "HES5" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215311 representing NM_001010926
Red=Cloning site Green=Tags(s) MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP PPALSAKATAAAAAAHQPACGLWRPW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001010926 |
Locus ID | 388585 |
UniProt ID | Q5TA89 |
Refseq Size | 1306 |
Cytogenetics | 1p36.32 |
Refseq ORF | 498 |
Synonyms | bHLHb38 |
Summary | This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Notch signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423234 | HES5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423234 | Transient overexpression lysate of hairy and enhancer of split 5 (Drosophila) (HES5) |
CNY 3,080.00 |
|
PH315311 | HES5 MS Standard C13 and N15-labeled recombinant protein (NP_001010926) |
CNY 19,520.00 |
|
TP760682 | Purified recombinant protein of Human hairy and enhancer of split 5 (Drosophila) (HES5), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |