Annexin A2 (ANXA2) (NM_001002858) Human Recombinant Protein
CAT#: TP315009
Recombinant protein of human annexin A2 (ANXA2), transcript variant 1, 20 µg
View other "Annexin A2" proteins (17)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215009 representing NM_001002858
Red=Cloning site Green=Tags(s) MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVD EVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLG TDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELID QDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQC IQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALL YLCGGDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002858 |
Locus ID | 302 |
UniProt ID | P07355 |
Refseq Size | 1635 |
Cytogenetics | 15q22.2 |
Refseq ORF | 1071 |
Synonyms | ANX2; ANX2L4; CAL1H; HEL-S-270; LIP2; LPC2; LPC2D; P36; PAP-IV |
Summary | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms. [provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome, Secreted Protein, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400369 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC400370 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418296 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427764 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429181 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400369 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 2 |
CNY 3,080.00 |
|
LY400370 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 1 |
CNY 3,080.00 |
|
LY418296 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 3 |
CNY 3,080.00 |
|
LY427764 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 4 |
CNY 3,080.00 |
|
PH304988 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_004030) |
CNY 19,520.00 |
|
PH305081 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001002857) |
CNY 19,520.00 |
|
PH315009 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001002858) |
CNY 19,520.00 |
|
PH327328 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001129487) |
CNY 19,520.00 |
|
TP304988 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP305081 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327328 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP750206 | Purified recombinant protein of Human annexin A2 (ANXA2), full length, tag free, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它Annexin A2产品