Annexin A2 (ANXA2) (NM_001002858) Human Mass Spec Standard
CAT#: PH315009
ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001002858)
View other "Annexin A2" proteins (17)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001002858) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215009 |
Predicted MW | 40.2 kDa |
Protein Sequence |
>RC215009 representing NM_001002858
Red=Cloning site Green=Tags(s) MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVD EVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLG TDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELID QDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQC IQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALL YLCGGDD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001002858 |
RefSeq Size | 1635 |
RefSeq ORF | 1071 |
Synonyms | ANX2; ANX2L4; CAL1H; HEL-S-270; LIP2; LPC2; LPC2D; P36; PAP-IV |
Locus ID | 302 |
Cytogenetics | 15q22.2 |
Summary | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms. [provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome, Secreted Protein, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400369 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC400370 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418296 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC427764 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429181 | ANXA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400369 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY400370 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY418296 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 3 |
CN¥ 3,080.00 |
|
LY427764 | Transient overexpression lysate of annexin A2 (ANXA2), transcript variant 4 |
CN¥ 3,080.00 |
|
PH304988 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_004030) |
CN¥ 19,520.00 |
|
PH305081 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001002857) |
CN¥ 19,520.00 |
|
PH327328 | ANXA2 MS Standard C13 and N15-labeled recombinant protein (NP_001129487) |
CN¥ 19,520.00 |
|
TP304988 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP305081 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP315009 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP327328 | Recombinant protein of human annexin A2 (ANXA2), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP750206 | Purified recombinant protein of Human annexin A2 (ANXA2), full length, tag free, expressed in E.coli, 50ug |
CN¥ 1,950.00 |
其它Annexin A2产品