Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201592) Human Recombinant Protein
CAT#: TP313529
Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 3, 20 µg
View other "Neuronal membrane glycoprotein M6 a" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213529 representing NM_201592
Red=Cloning site Green=Tags(s) MGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGDTLDVFTMIDIF KYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLP VYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGA GAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_963886 |
Locus ID | 2823 |
UniProt ID | P51674 |
Refseq Size | 2962 |
Cytogenetics | 4q34.2 |
Refseq ORF | 801 |
Synonyms | GPM6; M6A |
Summary | Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6A-induced filopodia formation involves mitogen-activated protein kinase (MAPK) and Src signaling pathways. May be involved in neuronal NGF-dependent Ca(2+) influx. May be involved in regulation of endocytosis and intracellular trafficking of G-protein-coupled receptors (GPCRs); enhances internalization and recycling of mu-type opioid receptor.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401623 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404475 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404476 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401623 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 1 |
CN¥ 3,080.00 |
|
LY404475 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 2 |
CN¥ 3,080.00 |
|
LY404476 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 3 |
CN¥ 3,080.00 |
|
PH305371 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963885) |
CN¥ 19,520.00 |
|
PH305432 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268) |
CN¥ 19,520.00 |
|
PH313529 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963886) |
CN¥ 19,520.00 |
|
TP305371 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP305432 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
其它Neuronal membrane glycoprotein M6 a产品