Neuronal membrane glycoprotein M6 a (GPM6A) (NM_005277) Human Mass Spec Standard
CAT#: PH305432
GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268)
View other "Neuronal membrane glycoprotein M6 a" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205432 |
Predicted MW | 31.2 kDa |
Protein Sequence |
>RC205432 protein sequence
Red=Cloning site Green=Tags(s) MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGD TLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA WLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMT FHLFIVALAGAGAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005268 |
RefSeq Size | 3215 |
RefSeq ORF | 834 |
Synonyms | GPM6; M6A |
Locus ID | 2823 |
Cytogenetics | 4q34.2 |
Summary | Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6A-induced filopodia formation involves mitogen-activated protein kinase (MAPK) and Src signaling pathways. May be involved in neuronal NGF-dependent Ca(2+) influx. May be involved in regulation of endocytosis and intracellular trafficking of G-protein-coupled receptors (GPCRs); enhances internalization and recycling of mu-type opioid receptor.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401623 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404475 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404476 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401623 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 1 |
CNY 3,080.00 |
|
LY404475 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 2 |
CNY 3,080.00 |
|
LY404476 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 3 |
CNY 3,080.00 |
|
PH305371 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963885) |
CNY 19,520.00 |
|
PH313529 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963886) |
CNY 19,520.00 |
|
TP305371 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP305432 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP313529 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Neuronal membrane glycoprotein M6 a产品