UBE2H (NM_182697) Human Recombinant Protein
CAT#: TP313095
Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 2, 20 µg
View other "UBE2H" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213095 representing NM_182697
Red=Cloning site Green=Tags(s) MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIDL TNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMS DFSEDEAQDMEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_874356 |
Locus ID | 7328 |
UniProt ID | P62256 |
Refseq Size | 2635 |
Cytogenetics | 7q32.2 |
Refseq ORF | 456 |
Synonyms | E2-20K; GID3; UBC8; UBCH; UBCH2 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq, Feb 2011] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401145 | UBE2H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405412 | UBE2H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401145 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1 |
CNY 3,080.00 |
|
LY405412 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 2 |
CNY 3,080.00 |
|
PH302516 | UBE2H MS Standard C13 and N15-labeled recombinant protein (NP_003335) |
CNY 19,520.00 |
|
PH313095 | UBE2H MS Standard C13 and N15-labeled recombinant protein (NP_874356) |
CNY 19,520.00 |
|
TP302516 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720162 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1 |
CNY 3,710.00 |