United States
Germany
Japan
United Kingdom
China
UBE2H (NM_182697) Human Mass Spec Standard
CAT＃: PH313095
UBE2H MS Standard C13 and N15-labeled recombinant protein (NP_874356)
View other "UBE2H" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | UBE2H MS Standard C13 and N15-labeled recombinant protein (NP_874356) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213095 |
| Predicted MW | 17 kDa |
| Protein Sequence |
>RC213095 representing NM_182697
Red=Cloning site Green=Tags(s) MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIDL TNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMS DFSEDEAQDMEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_874356 |
| RefSeq Size | 2635 |
| RefSeq ORF | 456 |
| Synonyms | E2-20K; GID3; UBC8; UBCH; UBCH2 |
| Locus ID | 7328 |
| Cytogenetics | 7q32.2 |
| Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq, Feb 2011] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401145 | UBE2H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405412 | UBE2H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401145 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1 |
CNY 3,080.00 |
|
| LY405412 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 2 |
CNY 3,080.00 |
|
| PH302516 | UBE2H MS Standard C13 and N15-labeled recombinant protein (NP_003335) |
CNY 19,520.00 |
|
| TP302516 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP313095 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720162 | Recombinant protein of human ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) (UBE2H), transcript variant 1 |
CNY 3,140.00 |
