TAF1 48 (TAF1A) (NM_005681) Human Recombinant Protein
CAT#: TP312971
Recombinant protein of human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1, 20 µg
View other "TAF1 48" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212971 representing NM_005681
Red=Cloning site Green=Tags(s) MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY ILKQDHQILGKKIKRMKRSVKKYSIVNPRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005672 |
Locus ID | 9015 |
UniProt ID | Q15573 |
Refseq Size | 1893 |
Cytogenetics | 1q41 |
Refseq ORF | 1350 |
Synonyms | MGC:17061; RAFI48; SL1; TAFI48 |
Summary | This gene encodes a subunit of the RNA polymerase I complex, Selectivity Factor I (SLI). The encoded protein is a TATA box-binding protein-associated factor that plays a role in the assembly of the RNA polymerase I preinitiation complex. Alternate splicing results in multiple transcript variants encoding multiple isoforms.[provided by RefSeq, Jan 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401732 | TAF1A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC408297 | TAF1A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401732 | Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1 |
CN¥ 3,080.00 |
|
LY408297 | Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2 |
CN¥ 3,080.00 |
|
PH312971 | TAF1A MS Standard C13 and N15-labeled recombinant protein (NP_005672) |
CN¥ 19,520.00 |
|
TP760550 | Purified recombinant protein of Human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |
其它TAF1 48产品