TAF1 48 (TAF1A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the N terminal of human TAF1A. Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	TATA-box binding protein associated factor, RNA polymerase I subunit A
Database Link	NP_005672 Entrez Gene 9015 Human UniProt ID Q15573
Background	Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, also known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the smallest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
Synonyms	MGC:17061; RAFI48; SL1; TAFI48
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Horse: 85%; Mouse: 85%; Rabbit: 85%; Pig: 78%; Rat: 78%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.