DARPP32 (PPP1R1B) (NM_032192) Human Recombinant Protein
CAT#: TP312689
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, 20 µg
View other "DARPP32" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212689 representing NM_032192
Red=Cloning site Green=Tags(s) MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPN PCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAE VLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115568 |
Locus ID | 84152 |
UniProt ID | Q9UD71 |
Refseq Size | 1841 |
Cytogenetics | 17q12 |
Refseq ORF | 612 |
Synonyms | DARPP-32; DARPP32 |
Summary | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403149 | PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405677 | PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403149 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1 |
CN¥ 3,080.00 |
|
LY405677 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2 |
CN¥ 3,080.00 |
|
PH300916 | PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_852606) |
CN¥ 19,520.00 |
|
PH312689 | PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_115568) |
CN¥ 19,520.00 |
|
TP300916 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
其它DARPP32产品