Her2 (ERBB2) (NM_004448) Human Recombinant Protein
CAT#: TP312583
Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), transcript variant 1, 20 µg
View other "Her2" proteins (18)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Cited in 3 publications. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212583 representing NM_004448
Red=Cloning site Green=Tags(s) MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNAS LSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLREL QLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFE SMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHL REVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLP DLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPH QALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHC LPCHPECQPQNGSVTCFGLEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC THSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPL TPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDE AYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGV TVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMA RDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSS STRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPL PSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGA VENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 137.7 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 27323861) ELISA capture for autoantibodies (PMID: 27793776) |
Reference Data | |
RefSeq | NP_004439 |
Locus ID | 2064 |
UniProt ID | P04626 |
Refseq Size | 4624 |
Cytogenetics | 17q12 |
Refseq ORF | 3765 |
Synonyms | CD340; HER-2; HER-2/neu; HER2; MLN 19; NEU; NGL; TKR1 |
Summary | This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Adherens junction, Bladder cancer, Calcium signaling pathway, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Dual-label time-resolved fluoroimmunoassay for simultaneous measurement of human epidermal growth factor receptor 2 and human epididymis protein 4 in serum
,Zhang, Y;Wang, K;Zhao, Y;Fan, J;Han, T;Si, Y;Zhou, B;Zhang, J;Hu, Z;Xie, M;,
J Anal Sci Technol
[ERBB2]
|
Case-Control Study: Smoking History Affects the Production of Tumor Antigen-Specific Antibodies NY-ESO-1 in Patients with Lung Cancer in Comparison with Cancer Disease-Free Group
,Myšíková, D;Adkins, I;Nad'a, H;Ondrej, P;Šimonek, J;Pozniak, J;Kolarík, J;Skallová-Fialová, A;Špíšek, R;Lischke, R;,
J Thorac Oncol
,PubMed ID 27793776
[ERBB2]
|
Expression of tumor antigens on primary ovarian cancer cells compared to established ovarian cancer cell lines
,Kloudová, K;Hromádková, H;Partlová, S;Brtnický, T;Rob, L;Bartunková, J;Hensler, M;Halaška, MJ;Špíšek, R;Fialová, A;,
Oncotarget
,PubMed ID 27323861
[ERBB2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417979 | ERBB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC423666 | ERBB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY417979 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), transcript variant 1 |
CN¥ 4,840.00 |
|
LY423666 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), transcript variant 2 |
CN¥ 4,840.00 |
|
PH312583 | ERBB2 MS Standard C13 and N15-labeled recombinant protein (NP_004439) |
CN¥ 19,520.00 |
|
PH322909 | ERBB2 MS Standard C13 and N15-labeled recombinant protein (NP_001005862) |
CN¥ 19,520.00 |
|
TP322909 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP700105 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), transcript variant 1, extracellular domain, 20 µg |
CN¥ 6,650.00 |
|
TP710004 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 2,neuro/glioblastoma derived oncogene homolog (avian) (ERBB2),residues 676-1255aa,with C-terminal DDK tag,expressed in sf9s, 20ug |
CN¥ 4,020.00 |
|
TP710032 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), full length, with C-terminal DDK tag, expressed in sf9 cells. |
CN¥ 4,020.00 |
|
TP710036 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), residues 23-652aa, with C-terminal DDK tag, expressed in sf9 cells. |
CN¥ 4,020.00 |
|
TP721313 | Human Her2 Protein (C-Fc) |
CN¥ 2,450.00 |
|
TP721314 | Human Her2 Protein (C-His) |
CN¥ 2,450.00 |
|
TP721315 | Human HER2 Protein (C-His-Avi) |
CN¥ 2,450.00 |
|
TP721316 | Biotinylated Human HER2 Protein (C-His-Avi) |
CN¥ 3,480.00 |
|
TP721317 | PE Conjugated Human Her2 Protein (C-His) |
CN¥ 3,480.00 |
|
TP721318 | APC Conjugated Human Her2 Protein (C-His) |
CN¥ 3,480.00 |
|
TP790102 | Purified recombinant protein of Human v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) (ERBB2), transcript variant 1, full length, with C-terminal DDK tag,expressed in CHO cells; |
CN¥ 6,650.00 |