TAS1R1 (NM_177540) Human Recombinant Protein
CAT#: TP312370
Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 20 µg
View other "TAS1R1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212370 representing NM_177540
Red=Cloning site Green=Tags(s) MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVTLCDRSCSFNE HGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTV LAVIGPDSTNRAATTAALLSPFLVPMLLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFT VLGSSTWSPVQLNINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLY RCQPCGKEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSAGGRL CFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIFKFSTKVPTFYHAWV QNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLECTETNSLGFILAFLYNGLLSISAFA CSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTASVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYV ILCRPDLNSTEHFQASIQDYTRRCGST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_803884 |
Locus ID | 80835 |
UniProt ID | Q7RTX1 |
Refseq Size | 1945 |
Cytogenetics | 1p36.31 |
Refseq ORF | 1761 |
Synonyms | GM148; GPR70; T1R1; TR1 |
Summary | The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Taste transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403591 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406077 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408549 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY403591 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 |
CNY 4,840.00 |
|
LY406077 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 4 |
CNY 3,080.00 |
|
LY408549 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 2 |
CNY 4,840.00 |
|
PH312370 | TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884) |
CNY 19,520.00 |