TAS1R1 Rabbit Polyclonal Antibody
CAT#: TA337751
Rabbit Polyclonal Anti-TAS1R1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | taste 1 receptor member 1 |
Database Link | |
Background | The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. |
Synonyms | GM148; GPR70; T1R1; TR1 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Rat: 91%; Dog: 86%; Bovine: 85%; Mouse: 83%; Rabbit: 83% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Taste transduction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |