United States
Germany
Japan
United Kingdom
China
PTP4A3 (NM_032611) Human Recombinant Protein
CAT＃: TP312193
Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, 20 µg
View other "PTP4A3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
| Cited in 2 publications. |
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212193 representing NM_032611
Red=Cloning site Green=Tags(s) MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGA INSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116000 |
| Locus ID | 11156 |
| UniProt ID | O75365 |
| Refseq Size | 1396 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 519 |
| Synonyms | PRL-3; PRL-R; PRL3 |
| Summary | This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Phosphatase |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
PRL-3 promotes ubiquitination and degradation of AURKA and colorectal cancer progression via dephosphorylation of FZR1
,Zhang, C;Qu, L;Lian, S;Meng, L;Min, L;Liu, J;Song, Q;Shen, L;Shou, C;,
Cancer Res.
,PubMed ID 30498084
[PTP4A3]
|
|
PRL-3 promotes telomere deprotection and chromosomal instability
,Lian, S;Meng, L;Yang, Y;Ma, T;Xing, X;Feng, Q;Song, Q;Liu, C;Tian, Z;Qu, L;Shou, C;,
Nucleic Acids Res.
,PubMed ID 28482095
[PTP4A3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410006 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416216 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410006 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1 |
CNY 3,080.00 |
|
| LY416216 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2 |
CNY 3,080.00 |
|
| PH312193 | PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_116000) |
CNY 19,520.00 |
|
| PH317944 | PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_009010) |
CNY 19,520.00 |
|
| TP317944 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761759 | Purified recombinant protein of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
