United States
Germany
Japan
United Kingdom
China
PTP4A3 (NM_032611) Human Mass Spec Standard
CAT＃: PH312193
PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_116000)
View other "PTP4A3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_116000) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212193 |
| Predicted MW | 19.4 kDa |
| Protein Sequence |
>RC212193 representing NM_032611
Red=Cloning site Green=Tags(s) MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGA INSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116000 |
| RefSeq Size | 1396 |
| RefSeq ORF | 519 |
| Synonyms | PRL-3; PRL-R; PRL3 |
| Locus ID | 11156 |
| Cytogenetics | 8q24.3 |
| Summary | This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410006 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416216 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410006 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1 |
CNY 3,080.00 |
|
| LY416216 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2 |
CNY 3,080.00 |
|
| PH317944 | PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_009010) |
CNY 19,520.00 |
|
| TP312193 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317944 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761759 | Purified recombinant protein of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
