KCNIP4 (NM_025221) Human Recombinant Protein
CAT#: TP311488
Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 1, 20 µg
View other "KCNIP4" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211488 representing NM_025221
Red=Cloning site Green=Tags(s) MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP EALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAV SFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVE TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079497 |
Locus ID | 80333 |
UniProt ID | Q6PIL6 |
Refseq Size | 1556 |
Cytogenetics | 4p15.31-p15.2 |
Refseq ORF | 750 |
Synonyms | CALP; KCHIP4 |
Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407777 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407778 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410769 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422121 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407777 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 3 |
CNY 3,080.00 |
|
LY407778 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 4 |
CNY 3,080.00 |
|
LY410769 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 1 |
CNY 3,080.00 |
|
LY422121 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 6 |
CNY 3,080.00 |
|
PH307464 | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_001030176) |
CNY 19,520.00 |
|
PH311488 | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_079497) |
CNY 19,520.00 |
|
PH311613 | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_671712) |
CNY 19,520.00 |
|
TP307464 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP311613 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP762665 | Purified recombinant protein of Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3 |
CNY 2,480.00 |