KCNIP4 (NM_147183) Human Mass Spec Standard
CAT#: PH311613
KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_671712)
View other "KCNIP4" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_671712) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211613 |
Predicted MW | 26.3 kDa |
Protein Sequence |
>RC211613 representing NM_147183
Red=Cloning site Green=Tags(s) MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILY RGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKL NWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIE SCQKDENIMRSMQLFENVI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_671712 |
RefSeq Size | 1373 |
RefSeq ORF | 687 |
Synonyms | CALP; KCHIP4 |
Locus ID | 80333 |
Cytogenetics | 4p15.31-p15.2 |
Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407777 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407778 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410769 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422121 | KCNIP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407777 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 3 |
CNY 3,080.00 |
|
LY407778 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 4 |
CNY 3,080.00 |
|
LY410769 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 1 |
CNY 3,080.00 |
|
LY422121 | Transient overexpression lysate of Kv channel interacting protein 4 (KCNIP4), transcript variant 6 |
CNY 3,080.00 |
|
PH307464 | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_001030176) |
CNY 19,520.00 |
|
PH311488 | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_079497) |
CNY 19,520.00 |
|
TP307464 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP311488 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311613 | Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP762665 | Purified recombinant protein of Human Kv channel interacting protein 4 (KCNIP4), transcript variant 3 |
CNY 2,480.00 |