TAS2R38 (NM_176817) Human Recombinant Protein
CAT#: TP311209
Recombinant protein of human taste receptor, type 2, member 38 (TAS2R38), 20 µg
View other "TAS2R38" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211209 protein sequence
Red=Cloning site Green=Tags(s) MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGL LFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKI SQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFL VSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCVAFISVPLLILWRDKIGVM VCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_789787 |
Locus ID | 5726 |
UniProt ID | P59533 |
Refseq Size | 1143 |
Cytogenetics | 7q34 |
Refseq ORF | 999 |
Synonyms | PTC; T2R38; T2R61; THIOT |
Summary | This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid combination PAV identifying the taster variant (and AVI identifying the non-taster variant). [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Taste transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403589 | TAS2R38 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403589 | Transient overexpression lysate of taste receptor, type 2, member 38 (TAS2R38) |
CNY 3,080.00 |
|
PH311209 | TAS2R38 MS Standard C13 and N15-labeled recombinant protein (NP_789787) |
CNY 19,520.00 |
其它TAS2R38产品