United States
Germany
Japan
United Kingdom
China
CD10 (MME) (NM_007288) Human Recombinant Protein
CAT＃: TP310961
Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2a, 20 µg
View other "CD10" proteins (21)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210961 protein sequence
Red=Cloning site Green=Tags(s) MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI QNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALY RSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK NSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELE KEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPE YLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSND NKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL QPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFS WDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 85.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009219 |
| Locus ID | 4311 |
| UniProt ID | P08473 |
| Refseq Size | 5665 |
| Cytogenetics | 3q25.2 |
| Refseq ORF | 2250 |
| Synonyms | CALLA; CD10; CMT2T; NEP; SCA43; SFE |
| Summary | The protein encoded by this gene is a type II transmembrane glycoprotein and a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). The encoded protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
| Protein Pathways | Alzheimer's disease, Hematopoietic cell lineage, Renin-angiotensin system |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400326 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC416064 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC416065 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416066 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC425018 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429337 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429338 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400326 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 |
CNY 4,840.00 |
|
| LY416064 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1bis |
CNY 4,840.00 |
|
| LY416065 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a |
CNY 3,080.00 |
|
| LY416066 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b |
CNY 4,840.00 |
|
| LY425018 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 |
CNY 4,840.00 |
|
| LY429337 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a |
CNY 4,840.00 |
|
| LY429338 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b |
CNY 4,840.00 |
|
| PH310961 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009219) |
CNY 19,520.00 |
|
| PH323013 | MME MS Standard C13 and N15-labeled recombinant protein (NP_000893) |
CNY 19,520.00 |
|
| PH323061 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009218) |
CNY 19,520.00 |
|
| PH323116 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009220) |
CNY 19,520.00 |
|
| TP323013 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323061 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1bis, 20 µg |
CNY 2,900.00 |
|
| TP323116 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2b, 20 µg |
CNY 2,900.00 |
