CD10 (MME) (NM_007289) Human Mass Spec Standard
CAT#: PH323116
MME MS Standard C13 and N15-labeled recombinant protein (NP_009220)
View other "CD10" proteins (21)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | MME MS Standard C13 and N15-labeled recombinant protein (NP_009220) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223116 |
Predicted MW | 85.3 kDa |
Protein Sequence |
>RC223116 representing NM_007289
Red=Cloning site Green=Tags(s) MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI QNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALY RSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK NSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELE KEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPE YLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSND NKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL QPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFS WDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009220 |
RefSeq Size | 5725 |
RefSeq ORF | 2250 |
Synonyms | CALLA; CD10; CMT2T; NEP; SCA43; SFE |
Locus ID | 4311 |
Cytogenetics | 3q25.2 |
Summary | The protein encoded by this gene is a type II transmembrane glycoprotein and a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). The encoded protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | Alzheimer's disease, Hematopoietic cell lineage, Renin-angiotensin system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400326 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC416064 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC416065 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC416066 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC425018 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC429337 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC429338 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY400326 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 |
CN¥ 4,840.00 |
|
LY416064 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1bis |
CN¥ 4,840.00 |
|
LY416065 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a |
CN¥ 3,080.00 |
|
LY416066 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b |
CN¥ 4,840.00 |
|
LY425018 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 |
CN¥ 4,840.00 |
|
LY429337 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a |
CN¥ 4,840.00 |
|
LY429338 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b |
CN¥ 4,840.00 |
|
PH310961 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009219) |
CN¥ 19,520.00 |
|
PH323013 | MME MS Standard C13 and N15-labeled recombinant protein (NP_000893) |
CN¥ 19,520.00 |
|
PH323061 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009218) |
CN¥ 19,520.00 |
|
TP310961 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2a, 20 µg |
CN¥ 2,900.00 |
|
TP323013 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP323061 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1bis, 20 µg |
CN¥ 2,900.00 |
|
TP323116 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2b, 20 µg |
CN¥ 2,900.00 |