Apolipoprotein A I (APOA1) (NM_000039) Human Recombinant Protein
CAT#: TP310762
Recombinant protein of human apolipoprotein A-I (APOA1), 20 µg
View other "Apolipoprotein A I" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210762 protein sequence
Red=Cloning site Green=Tags(s) MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKL LDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYR QKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGG ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000030 |
Locus ID | 335 |
UniProt ID | P02647 |
Refseq Size | 897 |
Cytogenetics | 11q23.3 |
Refseq ORF | 801 |
Synonyms | apo(a); HPALP2 |
Summary | This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400009 | APOA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400009 | Transient overexpression lysate of apolipoprotein A-I (APOA1) |
CNY 3,080.00 |
|
PH310762 | APOA1 MS Standard C13 and N15-labeled recombinant protein (NP_000030) |
CNY 19,520.00 |
|
TP720424 | Recombinant protein of human apolipoprotein A-I (APOA1) |
CNY 1,800.00 |
|
TP721184 | Purified recombinant protein of Human apolipoprotein A-I (APOA1) |
CNY 1,800.00 |
其它Apolipoprotein A I产品