Apolipoprotein A I (APOA1) (NM_000039) Human Mass Spec Standard
CAT#: PH310762
APOA1 MS Standard C13 and N15-labeled recombinant protein (NP_000030)
View other "Apolipoprotein A I" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | APOA1 MS Standard C13 and N15-labeled recombinant protein (NP_000030) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210762 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC210762 protein sequence
Red=Cloning site Green=Tags(s) MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKL LDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYR QKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGG ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000030 |
RefSeq Size | 897 |
RefSeq ORF | 801 |
Synonyms | apo(a); HPALP2 |
Locus ID | 335 |
Cytogenetics | 11q23.3 |
Summary | This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400009 | APOA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400009 | Transient overexpression lysate of apolipoprotein A-I (APOA1) |
CNY 3,080.00 |
|
TP310762 | Recombinant protein of human apolipoprotein A-I (APOA1), 20 µg |
CNY 2,900.00 |
|
TP720424 | Recombinant protein of human apolipoprotein A-I (APOA1) |
CNY 3,140.00 |
|
TP721184 | Purified recombinant protein of Human apolipoprotein A-I (APOA1) |
CNY 3,140.00 |
其它Apolipoprotein A I产品