H2A.Z (H2AFZ) (NM_002106) Human Recombinant Protein
CAT#: TP310691
Recombinant protein of human H2A histone family, member Z (H2AFZ), 20 µg
View other "H2A.Z" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210691 protein sequence
Red=Cloning site Green=Tags(s) MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002097 |
Locus ID | 3015 |
UniProt ID | P0C0S5 |
Refseq Size | 951 |
Cytogenetics | 4q23 |
Refseq ORF | 384 |
Synonyms | H2A.z; H2A.Z-1; H2A/z; H2AFZ; H2AZ |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419524 | H2AFZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419524 | Transient overexpression lysate of H2A histone family, member Z (H2AFZ) |
CNY 3,080.00 |
|
PH310691 | H2AFZ MS Standard C13 and N15-labeled recombinant protein (NP_002097) |
CNY 19,520.00 |
|
TP760276 | Recombinant protein of human H2A histone family, member Z (H2AFZ), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |