H2A.Z (H2AFZ) (NM_002106) Human Mass Spec Standard

Specifications

Product Data
Description	H2AFZ MS Standard C13 and N15-labeled recombinant protein (NP_002097)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC210691
Predicted MW	13.6 kDa
Protein Sequence	Sequence Link (showhide) >RC210691 protein sequence Red=Cloning site Green=Tags(s) MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_002097
RefSeq Size	951
RefSeq ORF	384
Synonyms	H2A.z; H2A.Z-1; H2A/z; H2AFZ; H2AZ
Locus ID	3015
Cytogenetics	4q23
Summary	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq, Jul 2008]
Protein Families	Druggable Genome
Protein Pathways	Systemic lupus erythematosus

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.