H2A.Z (H2AFZ) (NM_002106) Human Mass Spec Standard
CAT#: PH310691
H2AFZ MS Standard C13 and N15-labeled recombinant protein (NP_002097)
View other "H2A.Z" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | H2AFZ MS Standard C13 and N15-labeled recombinant protein (NP_002097) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210691 |
Predicted MW | 13.6 kDa |
Protein Sequence |
>RC210691 protein sequence
Red=Cloning site Green=Tags(s) MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002097 |
RefSeq Size | 951 |
RefSeq ORF | 384 |
Synonyms | H2A.z; H2A.Z-1; H2A/z; H2AFZ; H2AZ |
Locus ID | 3015 |
Cytogenetics | 4q23 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419524 | H2AFZ HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419524 | Transient overexpression lysate of H2A histone family, member Z (H2AFZ) |
CN¥ 3,080.00 |
|
TP310691 | Recombinant protein of human H2A histone family, member Z (H2AFZ), 20 µg |
CN¥ 2,900.00 |
|
TP760276 | Recombinant protein of human H2A histone family, member Z (H2AFZ), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |