POLR3H (NM_001018050) Human Recombinant Protein
CAT#: TP310633
Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, 20 µg
View other "POLR3H" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210633 protein sequence
Red=Cloning site Green=Tags(s) MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKV HFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDL YMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001018060 |
Locus ID | 171568 |
UniProt ID | Q9Y535, A0A024R1P3 |
Refseq Size | 4492 |
Cytogenetics | 22q13.2 |
Refseq ORF | 612 |
Synonyms | C25; RPC8; RPC22.9 |
Summary | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408616 | POLR3H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422705 | POLR3H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422706 | POLR3H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408616 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1 |
CNY 3,080.00 |
|
LY422705 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3 |
CNY 3,080.00 |
|
LY422706 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2 |
CNY 3,080.00 |
|
PH310633 | POLR3H MS Standard C13 and N15-labeled recombinant protein (NP_001018060) |
CNY 19,520.00 |