COP1 (RFWD2) (NM_022457) Human Recombinant Protein
CAT#: TP310492
Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 1, 20 µg
View other "COP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210492 protein sequence
Red=Cloning site Green=Tags(s) MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLV APAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICF DMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHS VSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLE QIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYN STLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSD YEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCC VKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKP YCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFV SAVCWRALPDGESNVLIAANSQGTIKVLELV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 80.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071902 |
Locus ID | 64326 |
UniProt ID | Q8NHY2 |
Refseq Size | 2806 |
Cytogenetics | 1q25.1-q25.2 |
Refseq ORF | 2193 |
Synonyms | CFAP78; FAP78; RFWD2; RNF200 |
Summary | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation. Upon binding to TRIB1, ubiquitinates CEBPA, which lacks a canonical COP1-binding motif (Probable).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | p53 signaling pathway, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411672 | RFWD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424225 | RFWD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY411672 | Transient overexpression lysate of ring finger and WD repeat domain 2 (RFWD2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY424225 | Transient overexpression lysate of ring finger and WD repeat domain 2 (RFWD2), transcript variant 2 |
CN¥ 4,840.00 |
|
PH310492 | RFWD2 MS Standard C13 and N15-labeled recombinant protein (NP_071902) |
CN¥ 14,250.00 |
|
PH311483 | RFWD2 MS Standard C13 and N15-labeled recombinant protein (NP_001001740) |
CN¥ 19,520.00 |
|
TP311483 | Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 2, 20 µg |
CN¥ 2,900.00 |