COP1 (RFWD2) (NM_001001740) Human Mass Spec Standard
CAT#: PH311483
RFWD2 MS Standard C13 and N15-labeled recombinant protein (NP_001001740)
View other "COP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RFWD2 MS Standard C13 and N15-labeled recombinant protein (NP_001001740) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211483 |
Predicted MW | 77.5 kDa |
Protein Sequence |
>RC211483 representing NM_001001740
Red=Cloning site Green=Tags(s) MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLV APAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICF DMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHS NGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREEMSGLYS PVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFST RMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKK IKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEK RCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYD LRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDY IACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGT IKVLELV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001001740 |
RefSeq Size | 2729 |
RefSeq ORF | 2121 |
Synonyms | CFAP78; FAP78; RFWD2; RNF200 |
Locus ID | 64326 |
Cytogenetics | 1q25.1-q25.2 |
Summary | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation. Upon binding to TRIB1, ubiquitinates CEBPA, which lacks a canonical COP1-binding motif (Probable).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | p53 signaling pathway, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411672 | RFWD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424225 | RFWD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY411672 | Transient overexpression lysate of ring finger and WD repeat domain 2 (RFWD2), transcript variant 1 |
CNY 3,080.00 |
|
LY424225 | Transient overexpression lysate of ring finger and WD repeat domain 2 (RFWD2), transcript variant 2 |
CNY 4,840.00 |
|
PH310492 | RFWD2 MS Standard C13 and N15-labeled recombinant protein (NP_071902) |
CNY 14,250.00 |
|
TP310492 | Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311483 | Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 2, 20 µg |
CNY 2,900.00 |