Nucleophosmin (NPM1) (NM_001037738) Human Recombinant Protein
CAT#: TP310458
Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3, 20 µg
View other "Nucleophosmin" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210458 protein sequence
Red=Cloning site Green=Tags(s) MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQN GKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKAH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032827 |
Locus ID | 4869 |
UniProt ID | P06748 |
Refseq Size | 1347 |
Cytogenetics | 5q35.1 |
Refseq ORF | 777 |
Synonyms | B23; NPM |
Summary | The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404681 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419282 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421985 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404681 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2 |
CNY 3,080.00 |
|
LY419282 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1 |
CNY 3,080.00 |
|
LY421985 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3 |
CNY 3,080.00 |
|
PH303344 | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_002511) |
CNY 19,520.00 |
|
PH303841 | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_954654) |
CNY 19,520.00 |
|
PH310458 | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001032827) |
CNY 19,520.00 |
|
TP303344 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP303841 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Nucleophosmin产品