RPE65 (NM_000329) Human Recombinant Protein
CAT#: TP310433
Recombinant protein of human retinal pigment epithelium-specific protein 65kDa (RPE65), 20 µg
View other "RPE65" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白,享双倍赠礼
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210433 representing NM_000329
Red=Cloning site Green=Tags(s) MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKF DFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFRGVEVTDNALVNVYPVG EDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIP PLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFE SNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENW EEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVV VSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.8 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000320 |
Locus ID | 6121 |
UniProt ID | Q16518 |
Refseq Size | 2608 |
Cytogenetics | 1p31.3 |
Refseq ORF | 1599 |
Synonyms | BCO3; LCA2; mRPE65; p63; rd12; RP20; sRPE65 |
Summary | The protein encoded by this gene is a component of the vitamin A visual cycle of the retina which supplies the 11-cis retinal chromophore of the photoreceptors opsin visual pigments. It is a member of the carotenoid cleavage oxygenase superfamily. All members of this superfamily are non-heme iron oxygenases with a seven-bladed propeller fold and oxidatively cleave carotenoid carbon:carbon double bonds. However, the protein encoded by this gene has acquired a divergent function that involves the concerted O-alkyl ester cleavage of its all-trans retinyl ester substrate and all-trans to 11-cis double bond isomerization of the retinyl moiety. As such, it performs the essential enzymatic isomerization step in the synthesis of 11-cis retinal. Mutations in this gene are associated with early-onset severe blinding disorders such as Leber congenital. [provided by RefSeq, Oct 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Retinol metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Antigen-specificity of antiretinal antibodies in patients with noninfectious uveitis
,Gibbs, E;Matsubara, J;Cao, S;Cui, J;Forooghian, F;,
Canadian Journal of Ophthalmology / Journal Canadien d'Ophtalmologie
[RPE65]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400124 | RPE65 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400124 | Transient overexpression lysate of retinal pigment epithelium-specific protein 65kDa (RPE65) |
CNY 3,080.00 |
|
PH310433 | RPE65 MS Standard C13 and N15-labeled recombinant protein (NP_000320) |
CNY 14,250.00 |
|
TP762502 | Purified recombinant protein of Human retinal pigment epithelium-specific protein 65kDa (RPE65), 340Tyr-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2,150.00 |