RPE65 (NM_000329) Human Mass Spec Standard
CAT#: PH310433
RPE65 MS Standard C13 and N15-labeled recombinant protein (NP_000320)
View other "RPE65" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | RPE65 MS Standard C13 and N15-labeled recombinant protein (NP_000320) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210433 |
Predicted MW | 61.4 kDa |
Protein Sequence |
>RC210433 representing NM_000329
Red=Cloning site Green=Tags(s) MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKF DFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFRGVEVTDNALVNVYPVG EDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIP PLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFE SNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENW EEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVV VSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000320 |
RefSeq Size | 2608 |
RefSeq ORF | 1599 |
Synonyms | BCO3; LCA2; mRPE65; p63; rd12; RP20; sRPE65 |
Locus ID | 6121 |
Cytogenetics | 1p31.3 |
Summary | The protein encoded by this gene is a component of the vitamin A visual cycle of the retina which supplies the 11-cis retinal chromophore of the photoreceptors opsin visual pigments. It is a member of the carotenoid cleavage oxygenase superfamily. All members of this superfamily are non-heme iron oxygenases with a seven-bladed propeller fold and oxidatively cleave carotenoid carbon:carbon double bonds. However, the protein encoded by this gene has acquired a divergent function that involves the concerted O-alkyl ester cleavage of its all-trans retinyl ester substrate and all-trans to 11-cis double bond isomerization of the retinyl moiety. As such, it performs the essential enzymatic isomerization step in the synthesis of 11-cis retinal. Mutations in this gene are associated with early-onset severe blinding disorders such as Leber congenital. [provided by RefSeq, Oct 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Retinol metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400124 | RPE65 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400124 | Transient overexpression lysate of retinal pigment epithelium-specific protein 65kDa (RPE65) |
CNY 3,080.00 |
|
TP310433 | Recombinant protein of human retinal pigment epithelium-specific protein 65kDa (RPE65), 20 µg |
CNY 2,900.00 |
|
TP762502 | Purified recombinant protein of Human retinal pigment epithelium-specific protein 65kDa (RPE65), 340Tyr-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2,150.00 |