alpha 5 Defensin (DEFA5) (NM_021010) Human Recombinant Protein
CAT#: TP310219
Recombinant protein of human defensin, alpha 5, Paneth cell-specific (DEFA5), 20 µg
View other "alpha 5 Defensin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210219 protein sequence
Red=Cloning site Green=Tags(s) MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG RCATRESLSGVCEISGRLYRLCCR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066290 |
Locus ID | 1670 |
UniProt ID | Q01523 |
Refseq Size | 468 |
Cytogenetics | 8p23.1 |
Refseq ORF | 282 |
Synonyms | DEF5; HD-5 |
Summary | Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Linking bacterial enterotoxins and alpha defensin 5 expansion in the Crohn\'s colitis: A new insight into the etiopathogenetic and differentiation triggers driving colonic inflammatory bowel disease
,Rana, T;Korolkova, OY;Rachakonda, G;Williams, AD;Hawkins, AT;James, SD;Sakwe, AM;Hui, N;Wang, L;Yu, C;Goodwin, JS;Izban, MG;Offodile, RS;Washington, MK;Ballard, BR;Smoot, DT;Shi, XZ;Forbes, DS;Shanker, A;M'Koma, AE;,
PloS one
,PubMed ID 33690604
[DEFA5]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412137 | DEFA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412137 | Transient overexpression lysate of defensin, alpha 5, Paneth cell-specific (DEFA5) |
CNY 3,080.00 |
|
PH310219 | DEFA5 MS Standard C13 and N15-labeled recombinant protein (NP_066290) |
CNY 19,520.00 |
其它alpha 5 Defensin产品