alpha 5 Defensin (DEFA5) (NM_021010) Human Mass Spec Standard
CAT#: PH310219
DEFA5 MS Standard C13 and N15-labeled recombinant protein (NP_066290)
View other "alpha 5 Defensin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DEFA5 MS Standard C13 and N15-labeled recombinant protein (NP_066290) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210219 |
Predicted MW | 10.1 kDa |
Protein Sequence |
>RC210219 protein sequence
Red=Cloning site Green=Tags(s) MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG RCATRESLSGVCEISGRLYRLCCR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066290 |
RefSeq Size | 468 |
RefSeq ORF | 282 |
Synonyms | DEF5; HD-5 |
Locus ID | 1670 |
Cytogenetics | 8p23.1 |
Summary | Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412137 | DEFA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412137 | Transient overexpression lysate of defensin, alpha 5, Paneth cell-specific (DEFA5) |
CNY 3,080.00 |
|
TP310219 | Recombinant protein of human defensin, alpha 5, Paneth cell-specific (DEFA5), 20 µg |
CNY 2,900.00 |
其它alpha 5 Defensin产品