United States
Germany
Japan
United Kingdom
China
IRF3 (NM_001571) Human Recombinant Protein
CAT＃: TP309951
Recombinant protein of human interferon regulatory factor 3 (IRF3), 20 µg
View other "IRF3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209951 protein sequence
Red=Cloning site Green=Tags(s) MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDK PDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDIL DELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFY RGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQW LWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGE SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD FQGPGES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001562 |
| Locus ID | 3661 |
| UniProt ID | Q14653 |
| Refseq Size | 1626 |
| Cytogenetics | 19q13.33 |
| Refseq ORF | 1281 |
| Synonyms | IIAE7 |
| Summary | This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7. [provided by RefSeq, Sep 2020] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400600 | IRF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434143 | IRF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434202 | IRF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400600 | Transient overexpression lysate of interferon regulatory factor 3 (IRF3) |
CNY 3,080.00 |
|
| LY434143 | Transient overexpression lysate of interferon regulatory factor 3 (IRF3), transcript variant 4 |
CNY 3,080.00 |
|
| LY434202 | Transient overexpression lysate of interferon regulatory factor 3 (IRF3), transcript variant 3 |
CNY 3,080.00 |
|
| PH309951 | IRF3 MS Standard C13 and N15-labeled recombinant protein (NP_001562) |
CNY 19,520.00 |
|
| TP331144 | Purified recombinant protein of Homo sapiens interferon regulatory factor 3 (IRF3), transcript variant 4, 20 µg |
CNY 2,900.00 |
Anti-IRF3 mouse monoclonal antibody, clone OTI5D2 (formerly 5D2)
