COQ9 (NM_020312) Human Recombinant Protein
CAT#: TP309578
Recombinant protein of human coenzyme Q9 homolog (S. cerevisiae) (COQ9), 20 µg
View other "COQ9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209578 protein sequence
Red=Cloning site Green=Tags(s) MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEK PDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGK DGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLP HNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDA MNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064708 |
Locus ID | 57017 |
UniProt ID | O75208 |
Refseq Size | 1699 |
Cytogenetics | 16q21 |
Refseq ORF | 954 |
Synonyms | C16orf49; COQ10D5 |
Summary | This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412553 | COQ9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412553 | Transient overexpression lysate of coenzyme Q9 homolog (S. cerevisiae) (COQ9) |
CNY 3,080.00 |
|
PH309578 | COQ9 MS Standard C13 and N15-labeled recombinant protein (NP_064708) |
CNY 19,520.00 |