Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_016291) Human Recombinant Protein
CAT#: TP309533
Recombinant protein of human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1, 20 µg
View other "Inositol Hexakisphosphate Kinase 2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209533 protein sequence
Red=Cloning site Green=Tags(s) MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK MKSHKLEEEFEWLKKSEVLYYTVEKKWNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI SEESGE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057375 |
Locus ID | 51447 |
UniProt ID | Q9UHH9 |
Refseq Size | 1813 |
Cytogenetics | 3p21.31 |
Refseq ORF | 1278 |
Synonyms | IHPK2; InsP6K2; PIUS |
Summary | This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414064 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423667 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC425158 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414064 | Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1 |
CNY 3,080.00 |
|
LY423667 | Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2 |
CNY 4,840.00 |
|
PH309533 | IP6K2 MS Standard C13 and N15-labeled recombinant protein (NP_057375) |
CNY 19,520.00 |
|
TP760718 | Purified recombinant protein of Human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Inositol Hexakisphosphate Kinase 2产品