Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_016291) Human Mass Spec Standard
CAT#: PH309533
IP6K2 MS Standard C13 and N15-labeled recombinant protein (NP_057375)
View other "Inositol Hexakisphosphate Kinase 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | IP6K2 MS Standard C13 and N15-labeled recombinant protein (NP_057375) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209533 |
Predicted MW | 49.3 kDa |
Protein Sequence |
>RC209533 protein sequence
Red=Cloning site Green=Tags(s) MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK MKSHKLEEEFEWLKKSEVLYYTVEKKWNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI SEESGE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057375 |
RefSeq Size | 1813 |
RefSeq ORF | 1278 |
Synonyms | IHPK2; InsP6K2; PIUS |
Locus ID | 51447 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414064 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423667 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC425158 | IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414064 | Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1 |
CNY 3,080.00 |
|
LY423667 | Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2 |
CNY 4,840.00 |
|
TP309533 | Recombinant protein of human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760718 | Purified recombinant protein of Human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Inositol Hexakisphosphate Kinase 2产品