POFUT2 (NM_133635) Human Recombinant Protein
CAT#: TP309505
Recombinant protein of human protein O-fucosyltransferase 2 (POFUT2), transcript variant 3, 20 µg
View other "POFUT2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209505 protein sequence
Red=Cloning site Green=Tags(s) MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLL KTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVL QSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNT SARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKL GSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMV RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE QPTHWKITY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_598368 |
Locus ID | 23275 |
UniProt ID | Q9Y2G5 |
Refseq Size | 2878 |
Cytogenetics | 21q22.3 |
Refseq ORF | 1287 |
Synonyms | C21orf80; FUT13 |
Summary | Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408775 | POFUT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC414699 | POFUT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY408775 | Transient overexpression lysate of protein O-fucosyltransferase 2 (POFUT2), transcript variant 3 |
CN¥ 3,080.00 |
|
LY414699 | Transient overexpression lysate of protein O-fucosyltransferase 2 (POFUT2), transcript variant 1 |
CN¥ 4,840.00 |
|
PH309505 | POFUT2 MS Standard C13 and N15-labeled recombinant protein (NP_598368) |
CN¥ 19,520.00 |