United States
Germany
Japan
United Kingdom
China
IL1RAP (NM_134470) Human Recombinant Protein
CAT＃: TP308786
Recombinant protein of human interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2, 20 µg
View other "IL1RAP" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208786 protein sequence
Red=Cloning site Green=Tags(s) MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY TCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK GNRCGQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_608273 |
| Locus ID | 3556 |
| UniProt ID | Q9NPH3 |
| Refseq Size | 2114 |
| Cytogenetics | 3q28 |
| Refseq ORF | 1068 |
| Synonyms | C3orf13; IL-1RAcP; IL1R3 |
| Summary | This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differing in their C-terminus. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. [provided by RefSeq, Jul 2018] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Apoptosis, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400791 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408731 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433294 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400791 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 1 |
CNY 4,840.00 |
|
| LY408731 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2 |
CNY 3,080.00 |
|
| LY433294 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 3 |
CNY 3,080.00 |
|
| PH308786 | IL1RAP MS Standard C13 and N15-labeled recombinant protein (NP_608273) |
CNY 19,520.00 |
|
| TP720670 | Purified recombinant protein of Human interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2 |
CNY 3,140.00 |
