VPS28 (NM_183057) Human Recombinant Protein
CAT#: TP308726
Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 20 µg
View other "VPS28" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208726 protein sequence
Red=Cloning site Green=Tags(s) MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWWVSLPARQSPAVPETLPARRSPAVPLR PSAPTCPVLHSQAADPERHVGVR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_898880 |
Locus ID | 51160 |
UniProt ID | Q9UK41 |
Refseq Size | 1112 |
Cytogenetics | 8q24.3 |
Refseq ORF | 699 |
Summary | This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405220 | VPS28 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414122 | VPS28 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405220 | Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2 |
CNY 3,080.00 |
|
LY414122 | Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1 |
CNY 3,080.00 |
|
PH300025 | VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_057292) |
CNY 19,520.00 |
|
PH308726 | VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_898880) |
CNY 19,520.00 |
|
TP300025 | Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP761364 | Purified recombinant protein of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |