ZFP200 (ZNF200) (NM_003454) Human Recombinant Protein
CAT#: TP307594
Recombinant protein of human zinc finger protein 200 (ZNF200), transcript variant 1, 20 µg
View other "ZFP200" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207594 protein sequence
Red=Cloning site Green=Tags(s) MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETL VIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLT SEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIP QKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPY DCNHCGKSFNHKTNLNKHERIHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEE FVLHLQSHEAERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003445 |
Locus ID | 7752 |
UniProt ID | P98182 |
Refseq Size | 3387 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1185 |
Summary | Could have a role in spermatogenesis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405074 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405075 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418671 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428893 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428894 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428895 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405074 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 3 |
CNY 3,080.00 |
|
LY405075 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 2 |
CNY 3,080.00 |
|
LY418671 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 1 |
CNY 3,080.00 |
|
LY428893 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 4 |
CNY 3,080.00 |
|
LY428894 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 5 |
CNY 3,080.00 |
|
LY428895 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 6 |
CNY 3,080.00 |
|
PH307594 | ZNF200 MS Standard C13 and N15-labeled recombinant protein (NP_003445) |
CNY 19,520.00 |
|
TP760180 | Recombinant protein of human zinc finger protein 200 (ZNF200), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP760732 | Purified recombinant protein of Human zinc finger protein 200 (ZNF200), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |