Profilin 2 (PFN2) (NM_053024) Human Recombinant Protein
CAT#: TP307366
Recombinant protein of human profilin 2 (PFN2), transcript variant 1, 20 µg
View other "Profilin 2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207366 protein sequence
Red=Cloning site Green=Tags(s) MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444252 |
Locus ID | 5217 |
UniProt ID | P35080 |
Refseq Size | 2117 |
Cytogenetics | 3q25.1 |
Refseq ORF | 420 |
Synonyms | D3S1319E; PFL |
Summary | The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400933 | PFN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409326 | PFN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400933 | Transient overexpression lysate of profilin 2 (PFN2), transcript variant 2 |
CNY 3,080.00 |
|
LY409326 | Transient overexpression lysate of profilin 2 (PFN2), transcript variant 1 |
CNY 3,080.00 |
|
PH307366 | PFN2 MS Standard C13 and N15-labeled recombinant protein (NP_444252) |
CNY 19,520.00 |
|
TP721010 | Purified recombinant protein of Human profilin 2 (PFN2), transcript variant 1 |
CNY 3,140.00 |
其它Profilin 2产品