Epsin 1 (EPN1) (NM_013333) Human Recombinant Protein
CAT#: TP307099
Recombinant protein of human epsin 1 (EPN1), transcript variant 3, 20 µg
View other "Epsin 1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207099 representing NM_013333
Red=Cloning site Green=Tags(s) MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKN WRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRL REERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEELQLQLALAMSKEEADQEERIRRGDD LRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAA DPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAF SDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRG SLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSV TNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037465 |
Locus ID | 29924 |
UniProt ID | Q9Y6I3 |
Refseq Size | 2430 |
Cytogenetics | 19q13.42 |
Refseq ORF | 1650 |
Summary | This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types. [provided by RefSeq, Mar 2016] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415639 | EPN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427145 | EPN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427146 | EPN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415639 | Transient overexpression lysate of epsin 1 (EPN1), transcript variant 3 |
CNY 3,080.00 |
|
LY427145 | Transient overexpression lysate of epsin 1 (EPN1), transcript variant 1 |
CNY 3,080.00 |
|
LY427146 | Transient overexpression lysate of epsin 1 (EPN1), transcript variant 2 |
CNY 3,080.00 |
|
PH307099 | EPN1 MS Standard C13 and N15-labeled recombinant protein (NP_037465) |
CNY 19,520.00 |
其它Epsin 1产品