KLF4 (NM_004235) Human Recombinant Protein
CAT#: TP306691
Recombinant protein of human Kruppel-like factor 4 (gut) (KLF4), 20 µg
View other "KLF4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206691 representing NM_004235
Red=Cloning site Green=Tags(s) MAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGA GAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCS FTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQ PPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLG AGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQ VPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCD WDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA assay (PMID: 25892221) |
Reference Data | |
RefSeq | NP_004226 |
Locus ID | 9314 |
UniProt ID | O43474 |
Refseq Size | 2639 |
Cytogenetics | 9q31.2 |
Refseq ORF | 1410 |
Synonyms | EZF; GKLF |
Summary | This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015] |
Protein Families | Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Kruppel-like factor4 regulates PRDM1 expression through binding to an autoimmune risk allele
,null,
JCI Insight
,PubMed ID 28097234
[KLF4]
|
Pioneer transcription factors target partial DNA motifs on nucleosomes to initiate reprogramming
,Soufi, A;Garcia, MF;Jaroszewicz, A;Osman, N;Pellegrini, M;Zaret, KS;,
Cell
,PubMed ID 25892221
[KLF4]
|
ZNF750 interacts with KLF4 and RCOR1, KDM1A, and CTBP1/2 chromatin regulators to repress epidermal progenitor genes and induce differentiation genes
,Boxer, LD;Barajas, B;Tao, S;Zhang, J;Khavari, PA;,
Genes Dev.
,PubMed ID 25228645
[KLF4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401356 | KLF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432255 | KLF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401356 | Transient overexpression lysate of Kruppel-like factor 4 (gut) (KLF4) |
CNY 3,080.00 |
|
LY432255 | Transient overexpression lysate of Kruppel-like factor 4 (gut) (KLF4) |
CNY 3,080.00 |
|
PH306691 | KLF4 MS Standard C13 and N15-labeled recombinant protein (NP_004226) |
CNY 19,520.00 |