KLF4 (NM_004235) Human Mass Spec Standard
CAT#: PH306691
KLF4 MS Standard C13 and N15-labeled recombinant protein (NP_004226)
View other "KLF4" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KLF4 MS Standard C13 and N15-labeled recombinant protein (NP_004226) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206691 |
Predicted MW | 49.9 kDa |
Protein Sequence |
>RC206691 representing NM_004235
Red=Cloning site Green=Tags(s) MAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGA GAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCS FTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQ PPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLG AGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQ VPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCD WDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004226 |
RefSeq Size | 2639 |
RefSeq ORF | 1410 |
Synonyms | EZF; GKLF |
Locus ID | 9314 |
Cytogenetics | 9q31.2 |
Summary | This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015] |
Protein Families | Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401356 | KLF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432255 | KLF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401356 | Transient overexpression lysate of Kruppel-like factor 4 (gut) (KLF4) |
CNY 3,080.00 |
|
LY432255 | Transient overexpression lysate of Kruppel-like factor 4 (gut) (KLF4) |
CNY 3,080.00 |
|
TP306691 | Recombinant protein of human Kruppel-like factor 4 (gut) (KLF4), 20 µg |
CNY 2,900.00 |